PDB entry 1mt1

View 1mt1 on RCSB PDB site
Description: The Crystal Structure of Pyruvoyl-dependent Arginine Decarboxylase from Methanococcus jannaschii
Class: lyase
Keywords: pyruvoyl group, pyruvate, agmatine, arginine, LYASE
Deposited on 2002-09-20, released 2003-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mt1.1
  • Chain 'B':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
      • modified residue (2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (73)
      • modified residue (80)
    Domains in SCOPe 2.06: d1mt1.1
  • Chain 'C':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mt1.2
  • Chain 'D':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
      • modified residue (2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (73)
      • modified residue (80)
    Domains in SCOPe 2.06: d1mt1.2
  • Chain 'E':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mt1.3
  • Chain 'F':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
      • modified residue (2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (73)
      • modified residue (80)
    Domains in SCOPe 2.06: d1mt1.3
  • Chain 'G':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mt1.4
  • Chain 'H':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
      • modified residue (2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (73)
      • modified residue (80)
    Domains in SCOPe 2.06: d1mt1.4
  • Chain 'I':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mt1.5
  • Chain 'J':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
      • modified residue (2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (73)
      • modified residue (80)
    Domains in SCOPe 2.06: d1mt1.5
  • Chain 'K':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mt1.6
  • Chain 'L':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
      • modified residue (2)
      • modified residue (16)
      • modified residue (55)
      • modified residue (73)
      • modified residue (80)
    Domains in SCOPe 2.06: d1mt1.6
  • Heterogens: AG2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1mt1A (A:)
mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris

    Sequence, based on observed residues (ATOM records): (download) 
    >1mt1A (A:)
plhayfklpntvslvagssegetplnafdgallnagignvnliris

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mt1B (B:)
ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1mt1C (C:)
mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris

    Sequence, based on observed residues (ATOM records): (download) 
    >1mt1C (C:)
inplhayfklpntvslvagssegetplnafdgallnagignvnliris

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mt1D (D:)
ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >1mt1E (E:)
mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris

    Sequence, based on observed residues (ATOM records): (download) 
    >1mt1E (E:)
aeinplhayfklpntvslvagssegetplnafdgallnagignvnliris

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mt1F (F:)
ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk

  • Chain 'G':
    Sequence, based on SEQRES records: (download) 
    >1mt1G (G:)
mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris

    Sequence, based on observed residues (ATOM records): (download) 
    >1mt1G (G:)
fklpntvslvagssegetplnafdgallnagignvnliris

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mt1H (H:)
ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk

  • Chain 'I':
    Sequence, based on SEQRES records: (download) 
    >1mt1I (I:)
mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris

    Sequence, based on observed residues (ATOM records): (download) 
    >1mt1I (I:)
einplhayfklpntvslvagssegetplnafdgallnagignvnliris

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mt1J (J:)
ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk

  • Chain 'K':
    Sequence, based on SEQRES records: (download) 
    >1mt1K (K:)
mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris

    Sequence, based on observed residues (ATOM records): (download) 
    >1mt1K (K:)
lhayfklpntvslvagssegetplnafdgallnagignvnliris

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mt1L (L:)
ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk