Lineage for d1mn3a_ (1mn3 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308367Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2308535Family a.5.2.4: CUE domain [88995] (4 protein domains)
    Pfam PF02845
  6. 2308545Protein Vacuolar protein sorting-associated protein vps9 [88996] (1 species)
  7. 2308546Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88997] (2 PDB entries)
  8. 2308547Domain d1mn3a_: 1mn3 A: [85024]
    part of the C-terminal helix-swapped homodimer

Details for d1mn3a_

PDB Entry: 1mn3 (more details), 2.3 Å

PDB Description: Cue domain of yeast Vps9p
PDB Compounds: (A:) Vacuolar protein sorting-associated protein VPS9

SCOPe Domain Sequences for d1mn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslikkieenerkdtlntlqnmfpdmdpsliedvciakksriepcvdallslse

SCOPe Domain Coordinates for d1mn3a_:

Click to download the PDB-style file with coordinates for d1mn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1mn3a_: