Lineage for d1mn3a_ (1mn3 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278490Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 278514Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 278536Family a.5.2.4: CUE domain [88995] (2 proteins)
  6. 278540Protein Vacuolar protein sorting-associated protein vps9 [88996] (1 species)
  7. 278541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88997] (2 PDB entries)
  8. 278542Domain d1mn3a_: 1mn3 A: [85024]
    part of the C-terminal helix-swapped homodimer
    complexed with mse; mutant

Details for d1mn3a_

PDB Entry: 1mn3 (more details), 2.3 Å

PDB Description: cue domain of yeast vps9p

SCOP Domain Sequences for d1mn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae)}
sslikkieenerkdtlntlqnmfpdmdpsliedvciakksriepcvdallslse

SCOP Domain Coordinates for d1mn3a_:

Click to download the PDB-style file with coordinates for d1mn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1mn3a_: