| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89059] (1 PDB entry) |
| Domain d1ml6b1: 1ml6 B:380-521 [85011] Other proteins in same PDB: d1ml6a2, d1ml6b2 complexed with gbx, ipa |
PDB Entry: 1ml6 (more details), 1.9 Å
SCOPe Domain Sequences for d1ml6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml6b1 a.45.1.1 (B:380-521) Class alpha GST {Mouse (Mus musculus), (a2-2) [TaxId: 10090]}
lygkdmkeralidmytegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdvhllelllyveeldaslltpfpllkafksrisslpnvkkflqp
gsqrkppldakqieearkvfkf
Timeline for d1ml6b1: