SCOPe 2.01: Domain d1ml6b1: 1ml6 B:380-521

Lineage for d1ml6b1 (1ml6 B:380-521)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89059] (1 PDB entry)

8. Domain d1ml6b1: 1ml6 B:380-521 [85011]
   Other proteins in same PDB: d1ml6a2, d1ml6b2
   complexed with gbx, ipa

Details for d1ml6b1

PDB Entry: 1ml6, 1.9 Å

PDB Description: Crystal Structure of mGSTA2-2 in Complex with the Glutathione Conjugate of Benzo[a]pyrene-7(R),8(S)-Diol-9(S),10(R)-Epoxide

PDB Compounds: (B:) Glutathione S-Transferase GT41A

SCOPe Domain Sequences for d1ml6b1:

Sequence; same for both SEQRES and ATOM records:

>d1ml6b1 a.45.1.1 (B:380-521) Class alpha GST {Mouse (Mus musculus), (a2-2) [TaxId: 10090]}
lygkdmkeralidmytegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdvhllelllyveeldaslltpfpllkafksrisslpnvkkflqp
gsqrkppldakqieearkvfkf

Timeline for d1ml6b1:

• d1ml6b1 first appeared in SCOP 1.65
  
• d1ml6b1 appears in SCOP 1.75
  
• d1ml6b1 appears in SCOPe 2.02
  
• d1ml6b1 appears in the current release, SCOPe 2.08