![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein YqiY [90013] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [90014] (1 PDB entry) |
![]() | Domain d1mk4a_: 1mk4 A: [84979] structural genomics |
PDB Entry: 1mk4 (more details), 1.7 Å
SCOPe Domain Sequences for d1mk4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} hmdirtitssdyemvtsvlnewwggrqlkeklprlffehfqdtsfitsehnsmtgfligf qsqsdpetayihfsgvhpdfrkmqigkqlydvfietvkqrgctrvkcvtspvnkvsiayh tklgfdiekgtktvngisvfanydgpgqdrvlfvkni
Timeline for d1mk4a_: