Lineage for d1mk4a1 (1mk4 A:1-156)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968569Protein Hypothetical protein YqiY [90013] (1 species)
  7. 2968570Species Bacillus subtilis [TaxId:1423] [90014] (1 PDB entry)
  8. 2968571Domain d1mk4a1: 1mk4 A:1-156 [84979]
    Other proteins in same PDB: d1mk4a2, d1mk4b2
    structural genomics

Details for d1mk4a1

PDB Entry: 1mk4 (more details), 1.7 Å

PDB Description: structure of protein of unknown function yqjy from bacillus subtilis, probable acetyltransferase
PDB Compounds: (A:) Hypothetical protein yqjY

SCOPe Domain Sequences for d1mk4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk4a1 d.108.1.1 (A:1-156) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}
mdirtitssdyemvtsvlnewwggrqlkeklprlffehfqdtsfitsehnsmtgfligfq
sqsdpetayihfsgvhpdfrkmqigkqlydvfietvkqrgctrvkcvtspvnkvsiayht
klgfdiekgtktvngisvfanydgpgqdrvlfvkni

SCOPe Domain Coordinates for d1mk4a1:

Click to download the PDB-style file with coordinates for d1mk4a1.
(The format of our PDB-style files is described here.)

Timeline for d1mk4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mk4a2