Lineage for d1mk4a_ (1mk4 A:)
- Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (14 proteins) 
Protein Hypothetical protein YqiY [90013] (1 species) Species Bacillus subtilis [TaxId:1423] [90014] (1 PDB entry) 
Domain d1mk4a_: 1mk4 A: [84979]
Details for d1mk4a_
PDB Entry: 1mk4 (more details), 1.7 Å
PDB Description: structure of protein of unknown function yqjy from bacillus subtilis, probable acetyltransferase
SCOP Domain Sequences for d1mk4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis}
hmdirtitssdyemvtsvlnewwggrqlkeklprlffehfqdtsfitsehnsmtgfligf
qsqsdpetayihfsgvhpdfrkmqigkqlydvfietvkqrgctrvkcvtspvnkvsiayh
tklgfdiekgtktvngisvfanydgpgqdrvlfvkni
SCOP Domain Coordinates for d1mk4a_:
Click to download the PDB-style file with coordinates for d1mk4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mk4a_:
- d1mk4a_ is new in SCOP 1.65
- d1mk4a_ appears in SCOP 1.67
- d1mk4a_ appears in the current release, SCOPe 2.08, called d1mk4a1
View in 3D
