Lineage for d1ma7a2 (1ma7 A:130-341)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605773Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2605774Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2605775Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2605776Protein Cre recombinase [56355] (1 species)
  7. 2605777Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
    Uniprot P06956 20-341
  8. 2605798Domain d1ma7a2: 1ma7 A:130-341 [84922]
    Other proteins in same PDB: d1ma7a1, d1ma7b1
    protein/DNA complex; mutant

Details for d1ma7a2

PDB Entry: 1ma7 (more details), 2.3 Å

PDB Description: Crystal structure of Cre site-specific recombinase complexed with a mutant DNA substrate, LoxP-A8/T27
PDB Compounds: (A:) cre recombinase

SCOPe Domain Sequences for d1ma7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ma7a2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOPe Domain Coordinates for d1ma7a2:

Click to download the PDB-style file with coordinates for d1ma7a2.
(The format of our PDB-style files is described here.)

Timeline for d1ma7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ma7a1