Lineage for d1m99a2 (1m99 A:1-80)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168430Protein Class alpha GST [81360] (8 species)
  7. 1168527Species Schistosoma japonicum [TaxId:6182] [52878] (12 PDB entries)
    Uniprot P08515
  8. 1168531Domain d1m99a2: 1m99 A:1-80 [84881]
    Other proteins in same PDB: d1m99a1
    complexed with gts

Details for d1m99a2

PDB Entry: 1m99 (more details), 2.3 Å

PDB Description: Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with glutathione sulfonic acid
PDB Compounds: (A:) Glutathione S-Transferase 26kDa

SCOPe Domain Sequences for d1m99a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m99a2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d1m99a2:

Click to download the PDB-style file with coordinates for d1m99a2.
(The format of our PDB-style files is described here.)

Timeline for d1m99a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m99a1