Lineage for d1m8la_ (1m8l A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2650710Fold j.11: VPR protein fragments [58353] (1 superfamily)
  4. 2650711Superfamily j.11.1: VPR protein fragments [58354] (1 family) (S)
  5. 2650712Family j.11.1.1: VPR protein fragments [58355] (1 protein)
  6. 2650713Protein VPR protein fragments [58356] (1 species)
  7. 2650714Species Human immunodeficiency virus type 1 [TaxId:11676] [58357] (12 PDB entries)
  8. 2650718Domain d1m8la_: 1m8l A: [84879]
    residues 1-96; globular structure: an open 3-helical bundle

Details for d1m8la_

PDB Entry: 1m8l (more details)

PDB Description: nmr structure of the hiv-1 regulatory protein vpr
PDB Compounds: (A:) vpr protein

SCOPe Domain Sequences for d1m8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8la_ j.11.1.1 (A:) VPR protein fragments {Human immunodeficiency virus type 1 [TaxId: 11676]}
meqapedqgpqrepyndwtlelleelkneavrhfpriwlhslgqhiyetygdtwtgveal
irilqqllfihfrigcrhsrigiiqqrrtrngasks

SCOPe Domain Coordinates for d1m8la_:

Click to download the PDB-style file with coordinates for d1m8la_.
(The format of our PDB-style files is described here.)

Timeline for d1m8la_: