PDB entry 1m8l

View 1m8l on RCSB PDB site
Description: NMR structure of the HIV-1 Regulatory Protein Vpr
Class: Viral protein
Keywords: Vpr, CD3CN, NMR structure, HIV-1, Viral protein
Deposited on 2002-07-25, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vpr protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q73369 (0-95)
  Domains in SCOPe 2.07: d1m8la_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m8lA (A:)
  meqapedqgpqrepyndwtlelleelkneavrhfpriwlhslgqhiyetygdtwtgveal
  irilqqllfihfrigcrhsrigiiqqrrtrngasks