Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [89198] (1 PDB entry) |
Domain d1lwra_: 1lwr A: [84731] second Fn3 module |
PDB Entry: 1lwr (more details)
SCOPe Domain Sequences for d1lwra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lwra_ b.1.2.1 (A:) Neural cell adhesion molecule 1, NCAM {Norway rat (Rattus norvegicus) [TaxId: 10116]} agpsapklegqmgedgnsikvnlikqddggspirhylvkyralasewkpeirlpsgsdhv mlksldwnaeyevyvvaenqqgkskaahfvfrtsaq
Timeline for d1lwra_: