PDB entry 1lwr

View 1lwr on RCSB PDB site
Description: Solution structure of the NCAM fibronectin type III module 2
Class: cell adhesion
Keywords: All beta, Fibronectin type III module, CELL ADHESION
Deposited on 2002-06-03, released 2003-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neural Cell Adhesion Molecule 1, 140 kDa isoform
  Species: Rattus norvegicus [TaxId:10116]
  Gene: NCAM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13596 (0-95)
    • cloning artifact (0-1)
  Domains in SCOPe 2.05: d1lwra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lwrA (A:)
  agpsapklegqmgedgnsikvnlikqddggspirhylvkyralasewkpeirlpsgsdhv
  mlksldwnaeyevyvvaenqqgkskaahfvfrtsaq