Lineage for d1ltlc_ (1ltl C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399942Family b.40.4.11: DNA replication initiator (cdc21/cdc54) N-terminal domain [89332] (1 protein)
  6. 2399943Protein DNA replication initiator (cdc21/cdc54) N-terminal domain [89333] (1 species)
    MCM complex protein; dodecamer assembly; includes the N-terminal all-alpha subdomain and inserted Zn-finger
  7. 2399944Species Methanobacterium thermoautotrophicum [TaxId:145262] [89334] (1 PDB entry)
  8. 2399947Domain d1ltlc_: 1ltl C: [84703]
    complexed with zn

Details for d1ltlc_

PDB Entry: 1ltl (more details), 3 Å

PDB Description: the dodecamer structure of mcm from archaeal m. thermoautotrophicum
PDB Compounds: (C:) DNA replication initiator (Cdc21/Cdc54)

SCOPe Domain Sequences for d1ltlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltlc_ b.40.4.11 (C:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl

SCOPe Domain Coordinates for d1ltlc_:

Click to download the PDB-style file with coordinates for d1ltlc_.
(The format of our PDB-style files is described here.)

Timeline for d1ltlc_: