PDB entry 1ltl

View 1ltl on RCSB PDB site
Description: the dodecamer structure of mcm from archaeal m. thermoautotrophicum
Class: replication
Keywords: replication
Deposited on 2002-05-20, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA replication initiator (Cdc21/Cdc54)
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltla_
  • Chain 'B':
    Compound: DNA replication initiator (Cdc21/Cdc54)
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltlb_
  • Chain 'C':
    Compound: DNA replication initiator (Cdc21/Cdc54)
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltlc_
  • Chain 'D':
    Compound: DNA replication initiator (Cdc21/Cdc54)
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltld_
  • Chain 'E':
    Compound: DNA replication initiator (Cdc21/Cdc54)
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltle_
  • Chain 'F':
    Compound: DNA replication initiator (Cdc21/Cdc54)
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ltlf_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ltlA (A:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlA (A:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ltlB (B:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlB (B:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ltlC (C:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlC (C:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ltlD (D:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlD (D:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ltlE (E:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlE (E:)
    mktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliek
    pddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktde
    irprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklq
    eplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnyte
    fl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ltlF (F:)
    gsgsrmktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdlad
    lliekpddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgiv
    rktdeirprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtq
    tlklqeplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiy
    gnytefleqefeelqiseedeekikelagdpniyekiir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ltlF (F:)
    vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
    viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
    rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
    enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl