Lineage for d1lt1a_ (1lt1 A:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3047948Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 3047949Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 3047950Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 3047951Protein Artificial diiron protein [58837] (1 species)
    dimeric alpha-hairpin fold
  7. 3047952Species Synthetic, different variants [58838] (12 PDB entries)
  8. 3047959Domain d1lt1a_: 1lt1 A: [84690]
    complexed with mn

Details for d1lt1a_

PDB Entry: 1lt1 (more details), 1.91 Å

PDB Description: sliding helix induced change of coordination geometry in a model di-mn(ii) protein
PDB Compounds: (A:) l13g-df1

SCOPe Domain Sequences for d1lt1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lt1a_ k.8.1.1 (A:) Artificial diiron protein {Synthetic, different variants}
dylrellklelqgikqyrealeyvklpvlakiledeekhiewletilg

SCOPe Domain Coordinates for d1lt1a_:

Click to download the PDB-style file with coordinates for d1lt1a_.
(The format of our PDB-style files is described here.)

Timeline for d1lt1a_: