SCOPe 2.08: Domain d1lt1b_: 1lt1 B:

Lineage for d1lt1b_ (1lt1 B:)

1. Root: SCOPe 2.08

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)

4. Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family)

5. Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
   this is not a true family

6. Protein Artificial diiron protein [58837] (1 species)
   dimeric alpha-hairpin fold

7. Species Synthetic, different variants [58838] (12 PDB entries)

8. Domain d1lt1b_: 1lt1 B: [84691]
   complexed with mn

Details for d1lt1b_

PDB Entry: 1lt1, 1.91 Å

PDB Description: sliding helix induced change of coordination geometry in a model di-mn(ii) protein

PDB Compounds: (B:) l13g-df1

SCOPe Domain Sequences for d1lt1b_:

Sequence; same for both SEQRES and ATOM records:

>d1lt1b_ k.8.1.1 (B:) Artificial diiron protein {Synthetic, different variants}
dylrellklelqgikqyrealeyvklpvlakiledeekhiewletilg

Timeline for d1lt1b_:

• d1lt1b_ first appeared in SCOP 1.65
  
• d1lt1b_ appears in SCOPe 2.07