Lineage for d1lrtb1 (1lrt B:2-100,B:231-485)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080683Species Tritrichomonas foetus [TaxId:5724] [51417] (10 PDB entries)
  8. 2080698Domain d1lrtb1: 1lrt B:2-100,B:231-485 [84686]
    there are two CBS domains in the disordered region 101-230
    complexed with bog, imp, k, tad, trs

Details for d1lrtb1

PDB Entry: 1lrt (more details), 2.2 Å

PDB Description: crystal structure of ternary complex of tritrichomonas foetus inosine- 5'-monophosphate dehydrogenase: structural characterization of nad+ site in microbial enzyme
PDB Compounds: (B:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d1lrtb1:

Sequence, based on SEQRES records: (download)

>d1lrtb1 c.1.5.1 (B:2-100,B:231-485) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfkXrylvgagintrdfrervpal
veagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfik
igigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtla
lamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfe
egvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsive

Sequence, based on observed residues (ATOM records): (download)

>d1lrtb1 c.1.5.1 (B:2-100,B:231-485) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfkXrylvgagintrdfrervpal
veagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfik
igigggsiceqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlalam
gadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwdsyvpyagklkdnveas
lnkvkstmcncgaltipqlqskakitlvssvsive

SCOPe Domain Coordinates for d1lrtb1:

Click to download the PDB-style file with coordinates for d1lrtb1.
(The format of our PDB-style files is described here.)

Timeline for d1lrtb1: