Lineage for d1lojf_ (1loj F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539178Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1539179Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1539225Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 1539245Domain d1lojf_: 1loj F: [84655]
    complexed with mpd, u, uri

Details for d1lojf_

PDB Entry: 1loj (more details), 1.9 Å

PDB Description: Crystal structure of a Methanobacterial Sm-like archaeal protein (SmAP1) bound to uridine-5'-monophosphate (UMP)
PDB Compounds: (F:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lojf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lojf_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
lirgdnivyisrgkl

SCOPe Domain Coordinates for d1lojf_:

Click to download the PDB-style file with coordinates for d1lojf_.
(The format of our PDB-style files is described here.)

Timeline for d1lojf_: