Lineage for d1lnxf_ (1lnx F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786640Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1786641Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1786737Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
    smap1
  8. 1786750Domain d1lnxf_: 1lnx F: [84647]
    complexed with acy, gol, uri

Details for d1lnxf_

PDB Entry: 1lnx (more details), 2.05 Å

PDB Description: Crystal structure of the P.aerophilum SmAP1 heptamer in a new crystal form (C2221)
PDB Compounds: (F:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lnxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnxf_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
vrgenvlfispvpg

SCOPe Domain Coordinates for d1lnxf_:

Click to download the PDB-style file with coordinates for d1lnxf_.
(The format of our PDB-style files is described here.)

Timeline for d1lnxf_: