| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
| Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries) smap1 |
| Domain d1lnxe_: 1lnx E: [84646] complexed with acy, gol, uri |
PDB Entry: 1lnx (more details), 2.05 Å
SCOPe Domain Sequences for d1lnxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnxe_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
vrgenvlfispvp
Timeline for d1lnxe_: