Lineage for d1lnxf_ (1lnx F:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296506Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 296507Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 296508Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 296509Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 296605Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
    smap1
  8. 296618Domain d1lnxf_: 1lnx F: [84647]

Details for d1lnxf_

PDB Entry: 1lnx (more details), 2.05 Å

PDB Description: Crystal structure of the P.aerophilum SmAP1 heptamer in a new crystal form (C2221)

SCOP Domain Sequences for d1lnxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnxf_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum}
cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
vrgenvlfispvpg

SCOP Domain Coordinates for d1lnxf_:

Click to download the PDB-style file with coordinates for d1lnxf_.
(The format of our PDB-style files is described here.)

Timeline for d1lnxf_: