![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49250] (10 PDB entries) |
![]() | Domain d1le9f1: 1le9 F:251-350 [84597] Other proteins in same PDB: d1le9a1, d1le9a2, d1le9b2, d1le9e1, d1le9e2, d1le9f2 protein/DNA complex |
PDB Entry: 1le9 (more details), 3 Å
SCOPe Domain Sequences for d1le9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1le9f1 b.1.18.1 (F:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]} vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv fktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Timeline for d1le9f1: