SCOPe 2.08: Domain d1le9f1: 1le9 F:251-350

Lineage for d1le9f1 (1le9 F:251-350)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)

8. Domain d1le9f1: 1le9 F:251-350 [84597]
   Other proteins in same PDB: d1le9a1, d1le9a2, d1le9a3, d1le9b2, d1le9e1, d1le9e2, d1le9e3, d1le9f2
   protein/DNA complex

Details for d1le9f1

PDB Entry: 1le9, 3 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti

PDB Compounds: (F:) nuclear factor nf-kappa-b p50 subunit

SCOPe Domain Sequences for d1le9f1:

Sequence; same for both SEQRES and ATOM records:

>d1le9f1 b.1.18.1 (F:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1le9f1:

• d1le9f1 first appeared in SCOP 1.65
  
• d1le9f1 appears in SCOPe 2.07