Lineage for d1l8hk_ (1l8h K:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536144Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 536188Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 536283Domain d1l8hk_: 1l8h K: [84548]

Details for d1l8hk_

PDB Entry: 1l8h (more details), 3.2 Å

PDB Description: dna protection and binding by e. coli dps protein

SCOP Domain Sequences for d1l8hk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8hk_ a.25.1.1 (K:) Dodecameric ferritin homolog {Escherichia coli, Dps}
nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
rkaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1l8hk_:

Click to download the PDB-style file with coordinates for d1l8hk_.
(The format of our PDB-style files is described here.)

Timeline for d1l8hk_: