Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1l8hk_ (1l8h K:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein Dodecameric ferritin homolog [47250] (14 species)
  7. Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. Domain d1l8hk_: 1l8h K: [84548]
    protein/DNA complex; complexed with k, trs

Details for d1l8hk_

PDB Entry: 1l8h (more details)
PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (K:) DNA protection during starvation protein

SCOP Domain Sequences for d1l8hk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8hk_ a.25.1.1 (K:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
rkaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1l8hk_:

Click to download the PDB-style file with coordinates for d1l8hk_.
(The format of our PDB-style files is described here.)

Timeline for d1l8hk_:

d1l8hk_ appears in SCOP 1.75A


d1l8hk_
(click for larger image)


d1l8hk_ in context of chain



d1l8hk_ in context of PDB
Domains from other chains:
d1l8ha_, d1l8hb_, d1l8hc_, d1l8hd_, d1l8he_, d1l8hf_, d1l8hg_, d1l8hh_, d1l8hi_, d1l8hj_, d1l8hl_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu