Lineage for d1jref_ (1jre F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484862Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1484885Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 1484915Domain d1jref_: 1jre F: [84198]
    protein/DNA complex; complexed with cd, trs

Details for d1jref_

PDB Entry: 1jre (more details), 2.65 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (F:) DNA protection during starvation protein

SCOPe Domain Sequences for d1jref_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jref_ a.25.1.1 (F:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1jref_:

Click to download the PDB-style file with coordinates for d1jref_.
(The format of our PDB-style files is described here.)

Timeline for d1jref_: