SCOPe 2.06: Domain d1jk6a_: 1jk6 A:

Lineage for d1jk6a_ (1jk6 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.9: Neurophysin II [49605] (1 superfamily)
   sandwich; 8 strands in 2 sheets; meander

4. Superfamily b.9.1: Neurophysin II [49606] (1 family)
   duplication: composed of two structural repeats
   automatically mapped to Pfam PF00184

5. Family b.9.1.1: Neurophysin II [49607] (1 protein)

6. Protein Neurophysin II [49608] (1 species)
   can be classified as disulfide-rich

7. Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)

8. Domain d1jk6a_: 1jk6 A: [84173]
   Des 1-6 protein

Details for d1jk6a_

PDB Entry: 1jk6, 2.4 Å

PDB Description: uncomplexed des 1-6 bovine neurophysin

PDB Compounds: (A:) neurophysin 2

SCOPe Domain Sequences for d1jk6a_:

Sequence; same for both SEQRES and ATOM records:

>d1jk6a_ b.9.1.1 (A:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
lrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccndescvtepecr

Timeline for d1jk6a_:

• d1jk6a_ first appeared in SCOP 1.65
  
• d1jk6a_ appears in SCOPe 2.05
  
• d1jk6a_ appears in SCOPe 2.07
  
• d1jk6a_ appears in the current release, SCOPe 2.08