Lineage for d1jk6a_ (1jk6 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 293538Fold b.9: Neurophysin II [49605] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 293539Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
    duplication: composed of two structural repeats
  5. 293540Family b.9.1.1: Neurophysin II [49607] (1 protein)
  6. 293541Protein Neurophysin II [49608] (1 species)
    can be classified as disulphide-rich
  7. 293542Species Cow (Bos taurus) [TaxId:9913] [49609] (6 PDB entries)
  8. 293544Domain d1jk6a_: 1jk6 A: [84173]

Details for d1jk6a_

PDB Entry: 1jk6 (more details), 2.4 Å

PDB Description: uncomplexed des 1-6 bovine neurophysin

SCOP Domain Sequences for d1jk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk6a_ b.9.1.1 (A:) Neurophysin II {Cow (Bos taurus)}
lrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccndescvtepecr

SCOP Domain Coordinates for d1jk6a_:

Click to download the PDB-style file with coordinates for d1jk6a_.
(The format of our PDB-style files is described here.)

Timeline for d1jk6a_:

293544
d1jk6a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1jk6c_