SCOP 1.67: Domain d1j2bb3: 1j2b B:361-505

Lineage for d1j2bb3 (1j2b B:361-505)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (2 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein)

6. Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species)
   the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries)

8. Domain d1j2bb3: 1j2b B:361-505 [84015]
   Other proteins in same PDB: d1j2ba1, d1j2ba2, d1j2bb1, d1j2bb2
   complexed with mg, zn

Details for d1j2bb3

PDB Entry: 1j2b, 3.3 Å

PDB Description: Crystal Structure Of Archaeosine tRNA-Guanine Transglycosylase Complexed With lambda-form tRNA(Val)

SCOP Domain Sequences for d1j2bb3:

Sequence; same for both SEQRES and ATOM records:

>d1j2bb3 d.17.6.1 (B:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Archaeon Pyrococcus horikoshii}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpy

Timeline for d1j2bb3:

• d1j2bb3 first appeared in SCOP 1.65
  
• d1j2bb3 appears in SCOP 1.69
  
• d1j2bb3 appears in the current release, SCOPe 2.08