Lineage for d1j2ba3 (1j2b A:361-505)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 409301Superfamily d.17.6: Pre-PUA domain [88802] (2 families) (S)
    this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
  5. 409302Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein)
  6. 409303Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species)
    the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain
  7. 409304Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries)
  8. 409311Domain d1j2ba3: 1j2b A:361-505 [84012]
    Other proteins in same PDB: d1j2ba1, d1j2ba2, d1j2bb1, d1j2bb2

Details for d1j2ba3

PDB Entry: 1j2b (more details), 3.3 Å

PDB Description: Crystal Structure Of Archaeosine tRNA-Guanine Transglycosylase Complexed With lambda-form tRNA(Val)

SCOP Domain Sequences for d1j2ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2ba3 d.17.6.1 (A:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Archaeon Pyrococcus horikoshii}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpy

SCOP Domain Coordinates for d1j2ba3:

Click to download the PDB-style file with coordinates for d1j2ba3.
(The format of our PDB-style files is described here.)

Timeline for d1j2ba3: