Lineage for d1j23a_ (1j23 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604516Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)
  6. 1604522Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species)
  7. 1604523Species Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries)
  8. 1604525Domain d1j23a_: 1j23 A: [84007]

Details for d1j23a_

PDB Entry: 1j23 (more details), 1.78 Å

PDB Description: crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain
PDB Compounds: (A:) ATP-dependent RNA helicase, putative

SCOPe Domain Sequences for d1j23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j23a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Pyrococcus furiosus [TaxId: 2261]}
vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidggl
fdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaqy
ifliakreqee

SCOPe Domain Coordinates for d1j23a_:

Click to download the PDB-style file with coordinates for d1j23a_.
(The format of our PDB-style files is described here.)

Timeline for d1j23a_: