Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) |
Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries) |
Domain d1j23a_: 1j23 A: [84007] |
PDB Entry: 1j23 (more details), 1.78 Å
SCOPe Domain Sequences for d1j23a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j23a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Pyrococcus furiosus [TaxId: 2261]} vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidggl fdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaqy ifliakreqee
Timeline for d1j23a_: