| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (23 families) ![]() |
| Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (1 protein) |
| Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species) |
| Species Archaeon Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries) |
| Domain d1j23a_: 1j23 A: [84007] |
PDB Entry: 1j23 (more details), 1.78 Å
SCOP Domain Sequences for d1j23a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j23a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Archaeon Pyrococcus furiosus}
vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidggl
fdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaqy
ifliakreqee
Timeline for d1j23a_: