SCOP 1.67: Domain d1j23a_: 1j23 A:

Lineage for d1j23a_ (1j23 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families)

5. Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (1 protein)

6. Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries)

8. Domain d1j23a_: 1j23 A: [84007]
   mutant

Details for d1j23a_

PDB Entry: 1j23, 1.78 Å

PDB Description: crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain

SCOP Domain Sequences for d1j23a_:

Sequence; same for both SEQRES and ATOM records:

>d1j23a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Archaeon Pyrococcus furiosus}
vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidggl
fdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaqy
ifliakreqee

Timeline for d1j23a_:

• d1j23a_ first appeared in SCOP 1.65
  
• d1j23a_ appears in SCOP 1.69
  
• d1j23a_ appears in the current release, SCOPe 2.08