| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) | 
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest  | 
Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]()  | 
| Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) | 
| Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species) | 
| Species Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries) | 
| Domain d1j22a_: 1j22 A: [84006] | 
PDB Entry: 1j22 (more details), 1.8 Å
SCOPe Domain Sequences for d1j22a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j22a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Pyrococcus furiosus [TaxId: 2261]}
vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidggl
fdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaqy
ifliakreqee
Timeline for d1j22a_: