Lineage for d1j22a_ (1j22 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316351Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 316352Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) (S)
  5. 316553Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (1 protein)
  6. 316554Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species)
  7. 316555Species Archaeon Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries)
  8. 316558Domain d1j22a_: 1j22 A: [84006]
    mutant

Details for d1j22a_

PDB Entry: 1j22 (more details), 1.8 Å

PDB Description: crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain, selenomet derivative

SCOP Domain Sequences for d1j22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j22a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Archaeon Pyrococcus furiosus}
vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidggl
fdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaqy
ifliakreqee

SCOP Domain Coordinates for d1j22a_:

Click to download the PDB-style file with coordinates for d1j22a_.
(The format of our PDB-style files is described here.)

Timeline for d1j22a_: