Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) |
Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (1 protein) |
Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries) |
Domain d1j22a_: 1j22 A: [84006] mutant |
PDB Entry: 1j22 (more details), 1.8 Å
SCOP Domain Sequences for d1j22a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j22a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Archaeon Pyrococcus furiosus} vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidggl fdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaqy ifliakreqee
Timeline for d1j22a_: