![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) ![]() form heterodimeric coiled coil |
![]() | Family h.1.25.2: Troponin I [90254] (1 protein) |
![]() | Protein Troponin I [90255] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries) |
![]() | Domain d1j1ec_: 1j1e C: [83971] Other proteins in same PDB: d1j1ea_, d1j1eb_, d1j1ed_, d1j1ee_ complexed with ca |
PDB Entry: 1j1e (more details), 3.3 Å
SCOPe Domain Sequences for d1j1ec_:
Sequence, based on SEQRES records: (download)
>d1j1ec_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens) [TaxId: 9606]} akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadam mqallgar
>d1j1ec_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens) [TaxId: 9606]} akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrvrisadammqallgar
Timeline for d1j1ec_: