Lineage for d1j1ec_ (1j1e C:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345534Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 345542Family h.1.25.2: Troponin I [90254] (1 protein)
  6. 345543Protein Troponin I [90255] (1 species)
  7. 345544Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries)
  8. 345547Domain d1j1ec_: 1j1e C: [83971]
    Other proteins in same PDB: d1j1ea_, d1j1eb_, d1j1ed_, d1j1ee_

Details for d1j1ec_

PDB Entry: 1j1e (more details), 3.3 Å

PDB Description: crystal structure of the 52kda domain of human cardiac troponin in the ca2+ saturated form

SCOP Domain Sequences for d1j1ec_:

Sequence, based on SEQRES records: (download)

>d1j1ec_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens)}
akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadam
mqallgar

Sequence, based on observed residues (ATOM records): (download)

>d1j1ec_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens)}
akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrvrisadammqallgar

SCOP Domain Coordinates for d1j1ec_:

Click to download the PDB-style file with coordinates for d1j1ec_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ec_: