SCOPe 2.08: Domain d1j12c2: 1j12 C:1-417

Lineage for d1j12c2 (1j12 C:1-417)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Bacterial beta-amylase [51485] (1 species)
   protein contains additional starch-binding domain

7. Species Bacillus cereus [TaxId:1396] [51486] (11 PDB entries)

8. Domain d1j12c2: 1j12 C:1-417 [83953]
   Other proteins in same PDB: d1j12a1, d1j12b1, d1j12c1, d1j12d1
   complexed with ca, ebg
   has additional subdomain(s) that are not in the common domain

Details for d1j12c2

PDB Entry: 1j12, 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with alpha- ebg

PDB Compounds: (C:) beta-amylase

SCOPe Domain Sequences for d1j12c2:

Sequence; same for both SEQRES and ATOM records:

>d1j12c2 c.1.8.1 (C:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

Timeline for d1j12c2:

• d1j12c2 first appeared in SCOP 1.65
  
• d1j12c2 appears in SCOPe 2.07