Lineage for d1j12c2 (1j12 C:1-417)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829995Protein Bacterial beta-amylase [51485] (1 species)
    protein contains additional starch-binding domain
  7. 2829996Species Bacillus cereus [TaxId:1396] [51486] (11 PDB entries)
  8. 2830018Domain d1j12c2: 1j12 C:1-417 [83953]
    Other proteins in same PDB: d1j12a1, d1j12b1, d1j12c1, d1j12d1
    complexed with ca, ebg
    has additional subdomain(s) that are not in the common domain

Details for d1j12c2

PDB Entry: 1j12 (more details), 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with alpha- ebg
PDB Compounds: (C:) beta-amylase

SCOPe Domain Sequences for d1j12c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j12c2 c.1.8.1 (C:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

SCOPe Domain Coordinates for d1j12c2:

Click to download the PDB-style file with coordinates for d1j12c2.
(The format of our PDB-style files is described here.)

Timeline for d1j12c2: