SCOPe 2.08: Domain d1j12a1: 1j12 A:418-516

Lineage for d1j12a1 (1j12 A:418-516)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)
Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
automatically mapped to Pfam PF00686
Protein beta-amylase [49462] (1 species)
Species Bacillus cereus [TaxId:1396] [49463] (12 PDB entries)
Domain d1j12a1: 1j12 A:418-516 [83948]
Other proteins in same PDB: d1j12a2, d1j12b2, d1j12c2, d1j12d2
complexed with ca, ebg

Details for d1j12a1

PDB Entry: 1j12 (more details), 2.1 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with alpha- ebg

PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1j12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j12a1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d1j12a1:

Click to download the PDB-style file with coordinates for d1j12a1.
(The format of our PDB-style files is described here.)

Timeline for d1j12a1: