SCOPe 2.01: Domain d1j08a1: 1j08 A:2-119

Lineage for d1j08a1 (1j08 A:2-119)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.2: PDI-like [52849] (2 proteins)
duplication: contains two tandem repeats of this fold
Protein Protein disulfide isomerase, PDI [52850] (5 species)
Species Pyrococcus horikoshii [TaxId:53953] [89702] (1 PDB entry)
glutaredoxin-like protein
Domain d1j08a1: 1j08 A:2-119 [83855]

Details for d1j08a1

PDB Entry: 1j08 (more details), 2.3 Å

PDB Description: Crystal structure of glutaredoxin-like protein from Pyrococcus horikoshii

PDB Compounds: (A:) glutaredoxin-like protein

SCOPe Domain Sequences for d1j08a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j08a1 c.47.1.2 (A:2-119) Protein disulfide isomerase, PDI {Pyrococcus horikoshii [TaxId: 53953]}
gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdt

SCOPe Domain Coordinates for d1j08a1:

Click to download the PDB-style file with coordinates for d1j08a1.
(The format of our PDB-style files is described here.)

Timeline for d1j08a1: