Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.2: PDI-like [52849] (2 proteins) duplication: contains two tandem repeats of this fold |
Protein Protein disulfide isomerase, PDI [52850] (3 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [89702] (1 PDB entry) glutaredoxin-like protein |
Domain d1j08a1: 1j08 A:2-119 [83855] |
PDB Entry: 1j08 (more details), 2.3 Å
SCOP Domain Sequences for d1j08a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j08a1 c.47.1.2 (A:2-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus horikoshii} gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdt
Timeline for d1j08a1: