SCOP 1.65: Domain d1j08a1: 1j08 A:2-119

Lineage for d1j08a1 (1j08 A:2-119)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.2: PDI-like [52849] (2 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein Protein disulfide isomerase, PDI [52850] (3 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [89702] (1 PDB entry)
   glutaredoxin-like protein

8. Domain d1j08a1: 1j08 A:2-119 [83855]

Details for d1j08a1

PDB Entry: 1j08, 2.3 Å

PDB Description: Crystal structure of glutaredoxin-like protein from Pyrococcus horikoshii

SCOP Domain Sequences for d1j08a1:

Sequence; same for both SEQRES and ATOM records:

>d1j08a1 c.47.1.2 (A:2-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus horikoshii}
gliseedkriikeeffskmvnpvklivfigkehcqycdqlkqlvqelseltdklsyeivd
fdtpegkelaekyridrapattitqdgkdfgvryfgipaghefaafledivdvskgdt

Timeline for d1j08a1:

• d1j08a1 is new in SCOP 1.65
  
• d1j08a1 appears in SCOP 1.67
  
• d1j08a1 appears in the current release, SCOPe 2.08