Lineage for d1iz5b2 (1iz5 B:126-246)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040996Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1040997Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1041062Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 1041084Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 1041148Species Pyrococcus furiosus [TaxId:2261] [55992] (4 PDB entries)
  8. 1041152Domain d1iz5b2: 1iz5 B:126-246 [83837]
    mutant

Details for d1iz5b2

PDB Entry: 1iz5 (more details), 1.8 Å

PDB Description: pyrococcus furiosus pcna mutant (met73leu, asp143ala, asp147ala): orthorhombic form
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1iz5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz5b2 d.131.1.2 (B:126-246) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}
pelpftakvvvlgevlkaavkaaslvsdsikfiarenefimkaegetqeveikltledeg
lldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllap
r

SCOPe Domain Coordinates for d1iz5b2:

Click to download the PDB-style file with coordinates for d1iz5b2.
(The format of our PDB-style files is described here.)

Timeline for d1iz5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iz5b1