Lineage for d1iyhd1 (1iyh D:676-799)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736098Protein Class sigma GST [81351] (5 species)
  7. 1736111Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1736131Domain d1iyhd1: 1iyh D:676-799 [83796]
    Other proteins in same PDB: d1iyha2, d1iyhb2, d1iyhc2, d1iyhd2
    complexed with gsh, mg

Details for d1iyhd1

PDB Entry: 1iyh (more details), 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase
PDB Compounds: (D:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d1iyhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyhd1 a.45.1.1 (D:676-799) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d1iyhd1:

Click to download the PDB-style file with coordinates for d1iyhd1.
(The format of our PDB-style files is described here.)

Timeline for d1iyhd1: