Lineage for d1hn0a2 (1hn0 A:25-234)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039775Family b.18.1.17: Chondroitin ABC lyase I, N-terminal domain [89236] (1 protein)
    automatically mapped to Pfam PF09092
  6. 2039776Protein Chondroitin ABC lyase I, N-terminal domain [89237] (1 species)
  7. 2039777Species Proteus vulgaris [TaxId:585] [89238] (1 PDB entry)
  8. 2039778Domain d1hn0a2: 1hn0 A:25-234 [83617]
    Other proteins in same PDB: d1hn0a1, d1hn0a3, d1hn0a4
    complexed with na

Details for d1hn0a2

PDB Entry: 1hn0 (more details), 1.9 Å

PDB Description: crystal structure of chondroitin abc lyase i from proteus vulgaris at 1.9 angstroms resolution
PDB Compounds: (A:) chondroitin abc lyase I

SCOPe Domain Sequences for d1hn0a2:

Sequence, based on SEQRES records: (download)

>d1hn0a2 b.18.1.17 (A:25-234) Chondroitin ABC lyase I, N-terminal domain {Proteus vulgaris [TaxId: 585]}
atsnpafdpknlmqseiyhfaqnnpladfssdknsiltlsdkrsimgnqsllwkwkggss
ftlhkklivptdkeaskawgrsstpvfsfwlynekpidgyltidfgeklistseaqagfk
vkldftgwravgvslnndlenremtlnatntssdgtqdsigrslgakvdsirfkapsnvs
qgeiyidrimfsvddaryqwsdyqvktrls

Sequence, based on observed residues (ATOM records): (download)

>d1hn0a2 b.18.1.17 (A:25-234) Chondroitin ABC lyase I, N-terminal domain {Proteus vulgaris [TaxId: 585]}
atsnpafdpknlmqseiyhfaqnnpladfssdknsiltlsdkrsimgnqsllwkwkggss
ftlhkklivptdkeaskawgrsstpvfsfwlynekpidgyltidfgeklistseaqagfk
vkldftgwravgvslnndlenvdsirfkapsnvsqgeiyidrimfsvddaryqwsdyqvk
trls

SCOPe Domain Coordinates for d1hn0a2:

Click to download the PDB-style file with coordinates for d1hn0a2.
(The format of our PDB-style files is described here.)

Timeline for d1hn0a2: