![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies) sandwich, 10 strands in 2 sheets; "folded meander" |
![]() | Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) ![]() |
![]() | Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins) |
![]() | Protein Chondroitin ABC lyase I [89266] (1 species) domain 4 |
![]() | Species Proteus vulgaris [TaxId:585] [89267] (1 PDB entry) |
![]() | Domain d1hn0a3: 1hn0 A:900-1021 [83618] Other proteins in same PDB: d1hn0a1, d1hn0a2, d1hn0a4 complexed with na |
PDB Entry: 1hn0 (more details), 1.9 Å
SCOPe Domain Sequences for d1hn0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hn0a3 b.24.1.1 (A:900-1021) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]} yqvlrkdkdvhiildklsnvtgyafyqpasiedkwikkvnkpaivmthrqkdtlivsavt pdlnmtrqkaatpvtinvtingkwqsadknsevkyqvsgdnteltftsyfgipqeiklsp lp
Timeline for d1hn0a3: