Lineage for d1hlqa_ (1hlq A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065038Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 1065039Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 1065040Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 1065041Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 1065071Species Rhodoferax fermentans, a phototrophic bacterium [TaxId:28066] [90197] (1 PDB entry)
  8. 1065072Domain d1hlqa_: 1hlq A: [83613]
    complexed with sf4, so4

Details for d1hlqa_

PDB Entry: 1hlq (more details), 1.45 Å

PDB Description: crystal structure of rhodoferax fermentans high potential iron-sulfur protein refined to 1.45 a
PDB Compounds: (A:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d1hlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlqa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Rhodoferax fermentans, a phototrophic bacterium [TaxId: 28066]}
aaplvaetdanakslgyvadttkadktkypkhtkdqscstcalyqgktapqgacplfagk
evvakgwcsawakka

SCOPe Domain Coordinates for d1hlqa_:

Click to download the PDB-style file with coordinates for d1hlqa_.
(The format of our PDB-style files is described here.)

Timeline for d1hlqa_: