| Class g: Small proteins [56992] (90 folds) |
| Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) ![]() |
| Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) |
| Protein HIPIP (high potential iron protein) [57654] (9 species) |
| Species Rhodoferax fermentans, a phototrophic bacterium [TaxId:28066] [90197] (1 PDB entry) |
| Domain d1hlqa_: 1hlq A: [83613] complexed with sf4, so4 |
PDB Entry: 1hlq (more details), 1.45 Å
SCOPe Domain Sequences for d1hlqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlqa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Rhodoferax fermentans, a phototrophic bacterium [TaxId: 28066]}
aaplvaetdanakslgyvadttkadktkypkhtkdqscstcalyqgktapqgacplfagk
evvakgwcsawakka
Timeline for d1hlqa_: