Lineage for d1hlqa_ (1hlq A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343805Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 343806Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 343807Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 343808Protein HIPIP (high potential iron protein) [57654] (7 species)
  7. 343833Species Phototrophic bacterium (Rhodoferax fermentans) [90197] (1 PDB entry)
  8. 343834Domain d1hlqa_: 1hlq A: [83613]

Details for d1hlqa_

PDB Entry: 1hlq (more details), 1.45 Å

PDB Description: crystal structure of rhodoferax fermentans high potential iron-sulfur protein refined to 1.45 a

SCOP Domain Sequences for d1hlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlqa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Phototrophic bacterium (Rhodoferax fermentans)}
aaplvaetdanakslgyvadttkadktkypkhtkdqscstcalyqgktapqgacplfagk
evvakgwcsawakka

SCOP Domain Coordinates for d1hlqa_:

Click to download the PDB-style file with coordinates for d1hlqa_.
(The format of our PDB-style files is described here.)

Timeline for d1hlqa_: